PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590572.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 285aa    MW: 33172.9 Da    PI: 4.9506
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590572.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.5e-142067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll  ++   G g+W++ a++ g++Rt+k+c++rw++yl
   XP_013590572.1 20 RGPWTLEEDTLLTTYILHNGEGRWNLAAKCAGLKRTGKSCRLRWLNYL 67
                     89********************************************97 PP

2Myb_DNA-binding51.91.7e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_013590572.1  73 RGNLTPQEQLLILELHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1191567IPR017930Myb domain
SuperFamilySSF466891.8E-2918114IPR009057Homeodomain-like
SMARTSM007172.5E-111969IPR001005SANT/Myb domain
PfamPF002494.5E-132067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-212174IPR009057Homeodomain-like
CDDcd001673.86E-82267No hitNo description
PROSITE profilePS5129425.26468122IPR017930Myb domain
SMARTSM007171.4E-1472120IPR001005SANT/Myb domain
PfamPF002491.4E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-2375121IPR009057Homeodomain-like
CDDcd001675.89E-1177116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MENSMKNKSF KESEEAKLRR GPWTLEEDTL LTTYILHNGE GRWNLAAKCA GLKRTGKSCR  60
LRWLNYLKPD IRRGNLTPQE QLLILELHSK WGNRWSKIAQ YLPGRTDNEI KNYWRTRVQK  120
QARQLNIESN SDKFFDAVRS FWVPRLIEKM EQNSSTTYAC PQNNNNNNNN NSSLLPPSQT  180
FESMSTQTYQ DLSGLSNMDG SSSSSAFMPD LMTVPHFMDP NTIIDGSMCY HEDNAQELSG  240
YILGTEEYYY MENSDISTEC QVAEAYENVT QDPMWNMDDI WQFRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23181225108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756550.0KM975655.1 Brassica napus MYB transcription factor 62.1 (MYB62.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590572.10.0PREDICTED: transcription factor MYB24
SwissprotQ9LDE16e-64MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D3CYX20.0A0A0D3CYX2_BRAOL; Uncharacterized protein
TrEMBLA0A078EL780.0A0A078EL78_BRANA; BnaC06g29460D protein
STRINGBra004297.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-145myb domain protein 62